PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn384621
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family B3
Protein Properties Length: 223aa    MW: 25214.7 Da    PI: 5.9065
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn384621genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B348.12.1e-151291913397
                 -SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
          B3  33 sktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                 +  +tl+ ++g++W v++ ++++s +  l+kGW eFv++  L+egD++vF+l++ +e  l+v++f
  Achn384621 129 GEFITLQVPKGEKWPVRCMWSNGSAK--LSKGWPEFVRDIMLDEGDVCVFELIKMEEIVLKVTIF 191
                 45699*************88888865..*************************988888888887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM010196.2E-599194IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.105.9E-16125192IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.0E-15125192IPR015300DNA-binding pseudobarrel domain
CDDcd100176.82E-15128191No hitNo description
PfamPF023621.9E-13130191IPR003340B3 DNA binding domain
PROSITE profilePS5086311.73132194IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 223 aa     Download sequence    Send to blast
MDSFEGRSCG NRCSIPCKEE AENDDKVEIF ENKVFDESLD QRKVGKSYDA SYVQYMGRNF  60
NGIELKSSHC TANGGNLRVG SILLSVERST RDMGIQCGYS ELTTSAYETR LPYLSQRPKI  120
SRKRKRGIGE FITLQVPKGE KWPVRCMWSN GSAKLSKGWP EFVRDIMLDE GDVCVFELIK  180
MEEIVLKVTI FHVIEDAEPL NQLPTKILFQ TSQLGNCYDL NG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4i1k_A1e-1612719577144B3 domain-containing transcription factor VRN
4i1k_B1e-1612719577144B3 domain-containing transcription factor VRN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA85571529
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G49480.13e-18related to vernalization1 1